missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Slain2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-57345-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Slain2 Polyclonal specifically detects Slain2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| Slain2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| KIAA1458FLJ21611, SLAIN motif family, member 2, SLAIN motif-containing protein 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 57606 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SLAIN2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPN | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido