missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sigma-1 R/OPRS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-82479-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sigma-1 R/OPRS1 Polyclonal antibody specifically detects Sigma-1 R/OPRS1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Especificaciones
| Sigma-1 R/OPRS1 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SIGMAR1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.1mg/mL | |
| Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 | |
| Aging-associated gene 8 protein, FLJ25585, hSigmaR1, OPRS1, SIG-1R, sigma 1, Sigma 1-type opioid receptor, sigma non-opioid intracellular receptor 1, sigma1 receptor, sigma1R, sigma1-receptor, SR31747 binding protein 1, SR31747-binding protein, SR-BP, SR-BP1, SRBPMGC3851, type I sigma receptor | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10280 | |
| Human, Rat | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Sigma-1 R/OPRS1 Antibody, Novus Biologicals™ > 25 μL; Unlabeled
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido