missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SHH (Human) Recombinant Protein (Q01)
Human SHH partial ORF with GST-tag at N-terminal
Marca: Abnova™ H00006469-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing.
- Theoretical MW: 36.74kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Especificaciones
| NP_000184 | |
| Solution | |
| 6469 | |
| SHH (Human) Recombinant Protein (Q01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SHH | |
| Human | |
| Yes |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 36.74 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDS | |
| HHG1/HLP3/HPE3/MCOPCB5/SMMCI/TPT/TPTPS | |
| SHH | |
| Wheat Germ (in vitro) | |
| GST |