missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
SGLT2/SLC5A2 Polyclonal antibody specifically detects SGLT2/SLC5A2 in Human, Mouse, Canine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Especificaciones
Especificaciones
| Antígeno | SGLT2/SLC5A2 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence reactivity reported in scientific literature (PMID: 25894829)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2 |
| Símbolos de los genes | SLC5A2 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?