missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERPINB13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 590.10€
Especificaciones
| Antígeno | SERPINB13 |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18245553
|
Novus Biologicals
NBP2-57225 |
100 μL |
 624.00€ 590.10€ / 100 microlitros Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18685577
|
Novus Biologicals
NBP2-57225-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
SERPINB13 Polyclonal specifically detects SERPINB13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| SERPINB13 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13, serpin B13, serpin peptidase inhibitor, clade B (ovalbumin), member 13, UV-B repressed sequence, HUR 7 | |
| SERPINB13 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5275 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto