missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. SERPINB13 Antibody, Novus Biologicals™

SERPINB13 Antibody, Novus Biologicals™

Produktkod. 18685577 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Cantidad:
100 μL
25 μL
Förpackningsstorlek:
100 microlitros
25 microlitros
Produktkod. Cantidad unitSize
18685577 25 μL 25 microlitros
18245553 100 μL 100 microlitros
2 options
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18685577

Brand: Novus Biologicals NBP25722525ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

SERPINB13 Polyclonal specifically detects SERPINB13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifikationer

Antígeno SERPINB13
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13, serpin B13, serpin peptidase inhibitor, clade B (ovalbumin), member 13, UV-B repressed sequence, HUR 7
Símbolos de los genes SERPINB13
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLF
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 5275
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Formulario Purified
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.