missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP3-35205-100ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Septin-11 Polyclonal antibody specifically detects Septin-11 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Especificaciones
| Septin-11 | |
| Polyclonal | |
| Western Blot 1:2000 - 1:6000, ELISA | |
| FLJ10849, septin 11, septin-11 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Septin-11 (NP_060713.1).,, Sequence:, MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEY | |
| 100 μL | |
| Cell Cycle and Replication | |
| 55752 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido