missing translation for 'onlineSavingsMsg'
Learn More

SEP15 Antibody, Novus Biologicals™

Código de producto. 18257509 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18257509 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18257509 Proveedor Novus Biologicals N.º de proveedor NBP191629

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

44454 Polyclonal specifically detects 44454 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno SEP15
Aplicaciones Western Blot
Clasificación Polyclonal
Concentración 0.5 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
N.º de referencia del gen O60613
Alias de gen 15 kDa selenoprotein
Símbolos de los genes 43358
Especie del huésped Rabbit
Inmunógeno Synthetic peptide directed towards the middle region of human SEP15The immunogen for this antibody is SEP15 (NP_004252). Peptide Sequence: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS
Método de purificación Affinity purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 9403
Especificidad de la prueba Expected identity based on immunogen sequence: Pig: 100%; Canine: 100%; Human: 100%; Zebrafish: 100%; Rat: 100%; Mouse: 100%; Bovine: 92%; Rainbow trout: 85%.
Reconstitución Centrifuge before reconstitution. Reconstitute in 50μL distilled water to a final antibody concentration 1mg/mL.
Especies diana Human, Mouse, Rat, Pig, Bovine, Zebrafish
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.