missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEP15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-91629
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
44454 Polyclonal specifically detects 44454 in Human samples. It is validated for Western Blot.
Especificaciones
| SEP15 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 15 kDa selenoprotein | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9403 | |
| Centrifuge before reconstitution. Reconstitute in 50μL distilled water to a final antibody concentration 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O60613 | |
| 43358 | |
| Synthetic peptide directed towards the middle region of human SEP15The immunogen for this antibody is SEP15 (NP_004252). Peptide Sequence: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Pig: 100%; Canine: 100%; Human: 100%; Zebrafish: 100%; Rat: 100%; Mouse: 100%; Bovine: 92%; Rainbow trout: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Zebrafish | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido