missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SCGB2A2 (Human) Recombinant Protein

Human SCGB2A2 full-length ORF ( AAI28403.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00004250-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16167791

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 17-07-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Especificaciones

Especificaciones

AAI28403.1
secretoglobin, family 2A, member 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SCGB2A2
GST
4250
Wheat germ expression system
10 μg
MGB1, MGC71974, UGB2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales