missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RIPX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP3-35284-20ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
RIPX Polyclonal antibody specifically detects RIPX in Mouse,Rat samples. It is validated for ELISA,Western Blot
Especificaciones
| RIPX | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| KIAA0871SINGAR1, protein RUFY3, rap2 interacting protein x, Rap2-interacting protein x, RIPx, RUN and FYVE domain containing 3, singar, Singar1, Single axon-regulated protein, single axon-related 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RIPX (NP_055776.1).,, Sequence:, MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM | |
| 20 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 22902 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido