missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
RENT1/UPF1/hUPF1 Polyclonal specifically detects RENT1/UPF1/hUPF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Especificaciones
Especificaciones
| Antígeno | RENT1/UPF1/hUPF1 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200, Knockdown Validated |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | ATP-dependent helicase RENT1, EC 3.6.1, EC 3.6.4.-, FLJ43809, HUPF1, KIAA0221FLJ46894, Nonsense mRNA reducing factor 1, NORF1delta helicase, pNORF1, regulator of nonsense transcripts 1, RENT1UP Frameshift 1, UPF1 regulator of nonsense transcripts homolog (yeast), up-frameshift mutation 1 homolog, Up-frameshift suppressor 1 homolog, yeast Upf1p homolog |
| Símbolos de los genes | UPF1 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?