missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. enQuireBio™ Recombinant SARS SARS MERS Protein

enQuireBio™ Recombinant SARS SARS MERS Protein

Código de producto. p-7151309
Click to view available options
Cantidad:
100 μg
1 mg
500 μg
Tamaño de la unidad:
1 miligramo
100 microgramos
500 microgramos
This item is not returnable. View return policy

Product Code. 15913509

Brand: enQuireBio™ QP13419100ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

A cDNA sequence encoding the SARS MERS was constructed and used to recombinantly synthesize the protein.

Specifications

Nombre SARS SARS MERS Protein
Cantidad 100 μg
Estado normativo Research Use Only
Concentración de endotoxinas Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Tipo de producto Recombinant Protein
Reactividad cruzada SARS
Especie E. coli
Etiqueta de proteína His
Secuencia EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH
Tampón SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide.
Grado de pureza o calidad Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.