missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit VCAM1 Protein

A cDNA sequence encoding the VCAM1 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13929-2ug

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15995149

  • 137.00€ / 2 microgramos
Fecha estimada de envío: 12-07-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

100008901
Greater than 90% as determined by SDS-PAGE.
Research Use Only
VCAM-1
Rabbit
His
The VCAM1 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
VCAM1 Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
Insect
AFKIETFPESRSLAQIGDSVSLTCTTTGCASPTFSWRTQIDSPLNGKVRSEGTTSTLTMDPVSFENE HSYLCTATCESKKLEKGIQVEIYSFPKDPEIHLSGPLEVGEPITVKCLVPDVYPFDRLEVDLLKGDYLM KKQDFLEDMDRKSLETKSLEVTFIPVIEDIGKLIVCRAKLHIDEIDSEPKERETTKELQVYISPKNTVIS VNPSTRLQEGGSVTMTCSSEGLPVPEIFWSKKQDNGNLQRLSGNATLTLIAMRMEDSGIYVCEG VNQIGKSRKEVELIVQEKPFTVEISPGPRIAAQIGDPVVLTCSVRGCETPSFSWRTQIDSPLNGQVT SEGTKSLLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIELSGPPVNGRPVTVSCKVP NVYPFDXLEIELLKGETMMKNKEFLEEEDKKSLETKSLEMTFIPTMEDTGKVLVCQAKLHIDEMEF EPKQRQSTQPLFVNVAPRDIAVWVSPSSIVEEGRSVNMTCSSYGLPAPKILWSRQLKNGDLQPLS ENTTLALISTKLEDSGIYVCEGINLAGKSRKEVELVIQVAPKDIQLTAFPSKSVKEGDTVIISCTCGNV PETWIILKKKAETGDTVLKSIDGAYTIRKAQLEDAGVYECESKNEVGSQLRSITLDVKGRENSKDYF SPE
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales