enQuireBio™ Recombinant Mouse Noggin Protein

A cDNA sequence encoding the Noggin was constructed and used to recombinantly synthesize the protein.

137.00€ - 5325.00€

Nombre	Noggin Protein
Estado normativo	Research Use Only
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Actividad biológica	The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 M 105 IU/mg in the presence of 5ng/ml BMP-4.
Tipo de producto	Recombinant Protein

Ver más especificaciones

Productos 3

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
15915198 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10795-5UG	5 μg	137.00€ 5 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

15905198 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10795-20UG	20 μg	211.00€ 20 microgramos Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

15995188 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	enQuireBio™ QP10795-1MG	1 mg	5325.00€ 1 miligramo Ver productos alternativos Ahorre hasta »	Fecha estimada de envío: 18-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Especificaciones

Nombre	Noggin Protein
Concentración de endotoxinas	< 1.0 EU per ug protein as determined by the LAL method.
Tipo de producto	Recombinant Protein
Especie	E. coli
Secuencia	MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Grado de pureza o calidad	Greater than 95.0% as determined by SDS-PAGE.

Estado normativo	Research Use Only
Actividad biológica	The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 M 105 IU/mg in the presence of 5ng/ml BMP-4.
Reactividad cruzada	Mouse
Etiqueta de proteína	Untagged
Tampón	Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

Descripción