missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

A cDNA sequence encoding the HIV-2 gp-36 397aa was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP12270-1mg

Detalles adicionales : Peso : 0.01000kg

 Ver más versiones de este producto

Código de producto. 15999888

  • 1810.00€ / 1 miligramo
Fecha estimada de envío: 11-07-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Especificaciones

Especificaciones

HIV-2 gp-36 397aa Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
Untagged
0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.
Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales