missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
RBM26 Polyclonal antibody specifically detects RBM26 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Especificaciones
Especificaciones
| Antígeno | RBM26 |
| Aplicaciones | ELISA, Western Blot |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500 - 1:2000, ELISA |
| Formulación | PBS (pH 7.3), 50% glycerol |
| Alias de gen | acidic rich RS domain containing 2, ARRS2, C13orf10, chromosome 13 open reading frame 10, CTCL tumor antigen se70-2, cutaneous T-cell lymphoma tumor antigen se70-2, FLJ20957, MGC133295, MGC133296, PRO1777, RNA binding motif protein 26, RNA-binding motif protein 26, RNA-binding protein 26, RP11-255E21.1, SE70-2, ZC3H17 |
| Especie del huésped | Rabbit |
| Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3).,, Sequence:, TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS |
| Método de purificación | Affinity purified |
| Mostrar más |
Título del producto
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?