missing translation for 'onlineSavingsMsg'
Learn More

RAB11B Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. 18622062 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18622062 0.1 mL 0.10 ml
18672062 0.02 mL 0.02 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18622062 Proveedor Novus Biologicals N.º de proveedor NBP2950940.1ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

RAB11B Polyclonal antibody specifically detects RAB11B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno RAB11B
Aplicaciones Western Blot, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen GTP-binding protein YPT3, H-YPT3, MGC133246, RAB11B, member of RAS oncogene family, RAB11B, member RAS oncogene family, ras-related protein Rab-11B, YPT3
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11B (NP_004209.2). ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
Método de purificación Affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Cancer, GPCR, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 9230
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.