missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTRF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 560.70€
Especificaciones
| Antígeno | PTRF |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18272583
|
Novus Biologicals
NBP2-57490 |
100 μL |
593.00€ 560.70€ / 100 microlitros Ahorro 32.30€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18638928
|
Novus Biologicals
NBP2-57490-25ul |
25 μL |
369.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
PTRF Polyclonal specifically detects PTRF in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| PTRF | |
| Polyclonal | |
| Rabbit | |
| Diabetes Research, Lipid and Metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 284119 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CAVIN, Cavin-1, CGL4, FLJ90031, polymerase I and transcript release factor, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12 | |
| PTRF | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto