Learn More
Abnova™ PTPRN Recombinant Protein
Descripción
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus.
- Theoretical MW (kDa): 37.51
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: LLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEG
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
Especificaciones
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Peso molecular | 37.51 |
| Nombre | Human PTPRN Partial ORF Recombinant Protein with GST-tag at N-terminal |
| Intervalo de pH | 8 |
| Método de preparación | In vitro wheat germ expression system |
| Método de purificación | Glutathione Sepharose 4 Fast Flow |
| Pruebas de control de calidad | 12.5% SDS-PAGE stained with Coomassie Blue |
| Cantidad | 10 μg |
| Fuente | Wheat Germ (in vitro) |
| Mostrar más |
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.