missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTPRD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
379.00€ - 585.00€
Especificaciones
| Antígeno | PTPRD |
|---|---|
| Dilución | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Aplicaciones | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18673827
|
Novus Biologicals
NBP2-49153-25ul |
25 μL |
379.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18672928
|
Novus Biologicals
NBP2-49153 |
0.1 mL |
585.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
PTPRD Polyclonal antibody specifically detects PTPRD in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Especificaciones
| PTPRD | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 5789 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| HPTPDELTA, HPTPMGC119752, MGC119750, MGC119751, protein tyrosine phosphatase, receptor type, D, Protein-tyrosine phosphatase delta, PTPDMGC119753, receptor type, delta polypeptide, receptor-type tyrosine-protein phosphatase delta | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto