missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTPRD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-49153-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
PTPRD Polyclonal antibody specifically detects PTPRD in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
| PTPRD | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| HPTPDELTA, HPTPMGC119752, MGC119750, MGC119751, protein tyrosine phosphatase, receptor type, D, Protein-tyrosine phosphatase delta, PTPDMGC119753, receptor type, delta polypeptide, receptor-type tyrosine-protein phosphatase delta | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE | |
| 25 μL | |
| Neuroscience, Signal Transduction | |
| 5789 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido