missing translation for 'onlineSavingsMsg'
Learn More

Proteasome 26S S5 Antibody, Novus Biologicals™

Código de producto. 18283246 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18283246 0.1 mL 0.10 ml
18406591 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18283246 Proveedor Novus Biologicals N.º de proveedor NBP187800

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Proteasome 26S S5 Polyclonal specifically detects Proteasome 26S S5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Proteasome 26S S5
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen KIAA007226S proteasome non-ATPase regulatory subunit 5, proteasome (prosome, macropain) 26S subunit, non-ATPase, 5,26S proteasome subunit S5B, S5BMGC23145,26S protease subunit S5 basic
Símbolos de los genes PSMD5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:AAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Neuroscience, Ubiquitin Proteasome Pathway
Primario o secundario Primary
ID de gen (Entrez) 5711
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.