missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 1/GALNT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
285.00€ - 500.00€
Especificaciones
| Antígeno | Polypeptide GalNac Transferase 1/GALNT1 |
|---|---|
| Dilución | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18409320
|
Novus Biologicals
NBP1-81852-25ul |
25 μL |
285.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18207117
|
Novus Biologicals
NBP1-81852 |
0.1 mL |
500.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Polypeptide GalNac Transferase 1/GALNT1 Polyclonal antibody specifically detects Polypeptide GalNac Transferase 1/GALNT1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Especificaciones
| Polypeptide GalNac Transferase 1/GALNT1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| EC 2.4.1.41, GalNAc transferase 1, GALNAC-T1, Polypeptide GalNAc transferase 1, polypeptide N-acetylgalactosaminyltransferase 1, pp-GaNTase 1, Protein-UDP acetylgalactosaminyltransferase 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1) | |
| GALNT1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2589 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto