missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 1/GALNT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-81852-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Polypeptide GalNac Transferase 1/GALNT1 Polyclonal antibody specifically detects Polypeptide GalNac Transferase 1/GALNT1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Especificaciones
| Polypeptide GalNac Transferase 1/GALNT1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 | |
| EC 2.4.1.41, GalNAc transferase 1, GALNAC-T1, Polypeptide GalNAc transferase 1, polypeptide N-acetylgalactosaminyltransferase 1, pp-GaNTase 1, Protein-UDP acetylgalactosaminyltransferase 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GALNT1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD | |
| 25 μL | |
| Stem Cell Markers | |
| 2589 | |
| Human, Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction