missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Plastin L Antibody, Novus Biologicals™

Plastin L Antibody, Novus Biologicals™

Código de producto. 18411192 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18411192 25 μL 25 microlitros
18061844 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18411192 Proveedor Novus Biologicals N.º de proveedor NBP18805725ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Plastin L Polyclonal specifically detects Plastin L in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antígeno Plastin L
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen CP64, DKFZp781A23186, FLJ25423, FLJ26114, FLJ39956, LC64PPLS2bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin)), LCP-1, LPL, L-plastin, L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P), Lymphocyte cytosolic protein 1, lymphocyte cytosolic protein 1 (L-plastin), Lymphocyte cytosolic protein-1 (plasmin), plastin 2, plastin-2
Símbolos de los genes LCP1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 3936
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Rat
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.