missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PKC gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 560.70€
Especificaciones
| Antígeno | PKC gamma |
|---|---|
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18656065
|
Novus Biologicals
NBP2-38569-25ul |
25 μL |
369.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18189977
|
Novus Biologicals
NBP2-38569 |
0.1 mL |
 593.00€ 560.70€ / 0.10 ml Ahorro 32.30€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
PKC gamma Polyclonal specifically detects PKC gamma in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| PKC gamma | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P05129 | |
| 5582 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.7.11, EC 2.7.11.13, MGC57564, PKCCSCA14, PKC-gamma, PKCGprotein kinase C gamma type, protein kinase C, gamma | |
| PRKCG | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto