missing translation for 'onlineSavingsMsg'
Learn More

PIKFyve/PIP5K3 Antibody, Novus Biologicals™

Código de producto. 18223477 Tienda Bio Techne Productos
Change view
Klicka för att se tillgängliga alternativ
Cantidad:
0.1 mL
25 μL
Förpackningsstorlek:
0.10 ml
25 microlitros
Produktkod. Cantidad unitSize
18223477 0.1 mL 0.10 ml
18411951 25 μL 25 microlitros
2 options
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18223477

Brand: Novus Biologicals NBP189613

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Denna artikel kan inte returneras. Se returpolicy

Rabbit Polyclonal Antibody

PIKFyve/PIP5K3 Polyclonal specifically detects PIKFyve/PIP5K3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antígeno PIKFyve/PIP5K3
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen 1-phosphatidylinositol-3-phosphate 5-kinase, EC 2.7.1.150, FLJ37746, FYVE finger-containing phosphoinositide kinase, KIAA0981CFD, MGC40423, p235, Phosphatidylinositol-3-phosphate 5-kinase, Phosphatidylinositol-3-phosphate 5-kinase type III, phosphoinositide kinase, FYVE finger containing, PIKfyve, PIP5K, PIP5K3FAB1, PIPkin-III, type III, Type III PIP kinase
Símbolos de los genes PIKFYVE
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:NVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQA
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Lipid and Metabolism
Primario o secundario Primary
ID de gen (Entrez) 200576
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.