missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Phospholemman Antibody - Azide and BSA Free, Novus Biologicals™

Phospholemman Antibody - Azide and BSA Free, Novus Biologicals™

Código de producto. p-200063575 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
Código de producto. Cantidad unitSize
18636412 0.02 mL 0.02 ml
18668152 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18636412

Marca: Novus Biologicals NBP2951650.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Phospholemman Polyclonal antibody specifically detects Phospholemman in Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Phospholemman
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen FXYD domain containing ion transport regulator 1, FXYD domain-containing ion transport regulator 1, MGC44983, PLMphospholemman
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 1-92 of human FXYD1 (NP_005022.2). MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 5348
Especies diana Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.