missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Phospholemman Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-95165-0.02ml
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Phospholemman Polyclonal antibody specifically detects Phospholemman in Mouse, Rat samples. It is validated for Western Blot
Especificaciones
| Phospholemman | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FXYD domain containing ion transport regulator 1, FXYD domain-containing ion transport regulator 1, MGC44983, PLMphospholemman | |
| A synthetic peptide corresponding to a sequence within amino acids 1-92 of human FXYD1 (NP_005022.2). MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR | |
| 0.02 mL | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 5348 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido