missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PBX1 (Human) Recombinant Protein

Human PBX1 partial ORF (NP_002576.1, 311 a.a. - 403 a.a.) recombinant protein with GST tag at N-terminal.

Marca:  Abnova™ H00005087-Q02.10ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16014505

  • 359.00€ / 10 microgramos
Fecha estimada de envío: 18-07-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: VTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANG
Especificaciones

Especificaciones

NP_002576.1
pre-B-cell leukemia homeobox 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PBX1
GST
5087
Wheat germ expression system
10 μg
DKFZp686B09108, MGC126627
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales