missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ PBX1 (Human) Recombinant Protein

Abnova™ PBX1 (Human) Recombinant Protein

Código de producto. p-7164536
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16014505

Marca: Abnova™ H00005087Q02.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
 Se alternative produkter

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Human PBX1 partial ORF (NP_002576.1, 311 a.a. - 403 a.a.) recombinant protein with GST tag at N-terminal.

  • Sequence: VTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANG

Tekniske data

Número de acceso NP_002576.1
ID de gen (Entrez) 5087
Nombre pre-B-cell leukemia homeobox 1
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Cantidad 10 μg
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen DKFZp686B09108, MGC126627
Símbolo de gen PBX1
Especie Wheat Germ (in vitro)
Etiqueta de proteína GST
Tampón 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.