missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pax5/BSAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Marca: Novus Biologicals NBP2-38790-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Pax5/BSAP Polyclonal specifically detects Pax5/BSAP in Human, Rat, Hamster samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| Pax5/BSAP | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q02548 | |
| PAX5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL | |
| 25 μL | |
| Cancer, Transcription Factors and Regulators | |
| 5079 | |
| Human, Rat, Hamster | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido