missing translation for 'onlineSavingsMsg'
Learn More

Pax5/BSAP Antibody, Novus Biologicals™

Código de producto. 18652466 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18652466 25 μL 25 microlitros
18009843 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18652466

Marca: Novus Biologicals NBP23879025ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 2 publications

Pax5/BSAP Polyclonal specifically detects Pax5/BSAP in Human, Rat, Hamster samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Pax5/BSAP
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q02548
Alias de gen B cell specific activator protein, B-cell-specific transcription factor, BSAPB-cell lineage specific activator, paired box 5, paired box gene 5 (B-cell lineage specific activator protein), paired box gene 5 (B-cell lineage specific activator), paired box homeotic gene 5, paired box protein Pax-5, transcription factor PAX 5
Símbolos de los genes PAX5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: SGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQL
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Transcription Factors and Regulators
Primario o secundario Primary
ID de gen (Entrez) 5079
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Rat, Hamster
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.