missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PATJ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Especificaciones
| Antígeno | PATJ |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18266492
|
Novus Biologicals
NBP2-57361 |
100 μL |
624.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18649496
|
Novus Biologicals
NBP2-57361-25ul |
25 μL |
415.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
PATJ Polyclonal specifically detects PATJ in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| PATJ | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10207 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| channel-interacting PDZ domain protein, FLJ26982, hINADL, inactivation no after-potential D-like protein, Inadl protein, InaD-like, InaD-like (Drosophila), inaD-like protein, Pals1-associated tight junction protein, PATJCipp, PDZ domain protein, Protein associated to tight junctions | |
| INADL | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto