missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pannexin-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-59672
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Pannexin-1 Polyclonal specifically detects Pannexin-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockout Validated.
Especificaciones
| Pannexin-1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 | |
| Rabbit | |
| 47 kDa | |
| 100 μL | |
| Primary | |
| Guinea pig 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Knockout Validated | |
| Q96RD7 | |
| PANX1 | |
| Synthetic peptides corresponding to PANX1(pannexin 1) The peptide sequence was selected from the middle region of PANX1. Peptide sequence LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN. | |
| Affinity purified | |
| RUO | |
| 24145 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido