missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PAFAH1B2 (Human) Recombinant Protein
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
- Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA
Especificaciones
Especificaciones
| Número de acceso | AAH00398 |
| ID de gen (Entrez) | 5049 |
| Nombre | platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa |
| Método de preparación | Wheat germ expression system |
| Pruebas de control de calidad | 125% SDS-PAGE Stained with Coomassie Blue |
| Cantidad | 25 μg |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Símbolo de gen | PAFAH1B2 |
| Especie | Wheat Germ (in vitro) |
| Etiqueta de proteína | GST |
| Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido