missing translation for 'onlineSavingsMsg'
Learn More

p38 gamma/SAPK3 Antibody, Novus Biologicals™

Código de producto. 18668485 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18668485 25 μL 25 microlitros
18142879 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18668485 Proveedor Novus Biologicals N.º de proveedor NBP23872925ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

p38 gamma/SAPK3 Polyclonal specifically detects p38 gamma/SAPK3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno p38 gamma/SAPK3
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen P53778
Alias de gen EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC 2.7.11.24, Stress-activated protein kinase 3
Símbolos de los genes MAPK12
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cell Cycle and Replication
Primario o secundario Primary
ID de gen (Entrez) 6300
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.