missing translation for 'onlineSavingsMsg'
Learn More

P2Y12/P2RY12 Antibody, Novus Biologicals™

Código de producto. p-200038491 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18496111 25 μL 25 microlitros
18785033 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18496111

Marca: Novus Biologicals NBP23387025ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 5 publications

P2Y12/P2RY12 Polyclonal specifically detects P2Y12/P2RY12 in Human, Canine, Feline samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno P2Y12/P2RY12
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot - reported in scientific literature (PMID:31968618)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence -validated from a verified customer review, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen -validated from a verified customer review
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q9H244
Alias de gen ADPG-R, Gi-coupled ADP receptor HORK3, HORK3P2Y12 platelet ADP receptor, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12ADP-glucose receptor, purinergic receptor P2RY12, purinergic receptor P2Y, G-protein coupled, 12, putative G-protein coupled receptor, SP1999G-protein coupled receptor SP1999
Símbolos de los genes P2RY12
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación GPCR
Primario o secundario Primary
ID de gen (Entrez) 64805
Especificidad de la prueba Specificity of human P2Y12/P2RY12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human, Feline
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.