missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2X7/P2RX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-82738-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
P2X7/P2RX7 Polyclonal specifically detects P2X7/P2RX7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| P2X7/P2RX7 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| P2RX7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.7mg/mL | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| ATP receptor, MGC20089, P2X purinoceptor 7, P2X7P2X7 receptor, P2X7R, P2Z receptor, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 7, purinergic receptor P2X7 variant A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5027 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
P2X7/P2RX7 Antibody, Novus Biologicals™ > 25 μL; Unlabeled
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido