missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OXCT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | OXCT1 |
|---|---|
| Dilución | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Aplicaciones | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18620008
|
Novus Biologicals
NBP2-49331-25ul |
25 μL |
 415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18639807
|
Novus Biologicals
NBP2-49331 |
0.1 mL |
624.00€ 590.10€ / 0.10 ml Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
OXCT1 Polyclonal antibody specifically detects OXCT1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Especificaciones
| OXCT1 | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 5019 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 3-oxoacid CoA transferase 1,3-oxoacid CoA transferase, EC 2.8.3, EC 2.8.3.5, SCOTmitochondrial | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto