missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OXCT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-49331
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
OXCT1 Polyclonal antibody specifically detects OXCT1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
| OXCT1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| 3-oxoacid CoA transferase 1,3-oxoacid CoA transferase, EC 2.8.3, EC 2.8.3.5, SCOTmitochondrial | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 5019 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido