missing translation for 'onlineSavingsMsg'
Learn More

Osteopontin/OPN Antibody, Novus Biologicals™

Código de producto. 18411802 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Unit Size:
0.10 ml
25 microlitros
Product Code. Cantidad unitSize
18411802 0.1 mL 0.10 ml
18463792 25 μL 25 microlitros
2 options
This item is not returnable. View return policy

Product Code. 18411802

Brand: Novus Biologicals NBP189952

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Osteopontin/OPN Polyclonal antibody specifically detects Osteopontin/OPN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Osteopontin/OPN
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen BNSP, Bone sialoprotein 1, MGC110940, Nephropontin, osteopontin, secreted phosphoprotein 1bone sialoprotein I, early T-lymphocyteactivation 1), secreted phosphoprotein-1 (osteopontin, bone sialoprotein), SPP-1, SPP1/CALPHA1 fusion, Urinary stone protein, uropontin
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Apoptosis, Cancer, Cellular Markers, Extracellular Matrix, Hypoxia
Primario o secundario Primary
ID de gen (Entrez) 6696
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Política de privacidad.