missing translation for 'onlineSavingsMsg'
Learn More

Osteocalcin Antibody (190125), PE, Novus Biologicals™

Código de producto. 30036980 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
Tamaño de la unidad:
0.10 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30036980 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30036980 Proveedor Novus Biologicals N.º de proveedor FAB1419P

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse Monoclonal Antibody

Osteocalcin Monoclonal antibody specifically detects Osteocalcin in Human, Rat samples. It is validated for Immunohistochemistry, Flow Cytometry, Immunocytochemistry, CyTOF
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Osteocalcin
Aplicaciones Immunohistochemistry, Flow Cytometry, Immunocytochemistry, CyTOF
Clasificación Monoclonal
Clon 190125
Conjugado PE
Dilución Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready
Formulación PBS
Alias de gen BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
Especie del huésped Mouse
Inmunógeno Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818
Método de purificación Protein A or G purified from hybridoma culture supernatant
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Extracellular Matrix, Stem Cell Markers
Primario o secundario Primary
ID de gen (Entrez) 632
Especies diana Human, Rat
Contenido y almacenamiento Store at 4C in the dark.
Formulario Purified
Isotype IgG1
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.