missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. OGR1 Antibody - BSA Free, Novus Biologicals™

OGR1 Antibody - BSA Free, Novus Biologicals™

Product Code. 18623561 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Unit Size:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Cantidad unitSize
18623561 0.1 mL 0.10 ml
18667711 0.02 mL 0.02 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18623561 Supplier Novus Biologicals Supplier No. NBP2930670.1ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

OGR1 Polyclonal antibody specifically detects OGR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-Out
TRUSTED_SUSTAINABILITY

Specifications

Antígeno OGR1
Aplicaciones Western Blot, Gene Knock-Out
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500 - 1:1000, Knockout Validated
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen G protein-coupled receptor 68, GPR12A, G-protein coupled receptor 68, OGR-1, ovarian cancer G protein-coupled receptor, 1, ovarian cancer G-protein coupled receptor 1, Sphingosylphosphorylcholine receptor
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA
Método de purificación Affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación GPCR
Primario o secundario Primary
ID de gen (Entrez) 8111
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.