missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUCKS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Especificaciones
| Antígeno | NUCKS1 |
|---|---|
| Dilución | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Aplicaciones | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18636566
|
Novus Biologicals
NBP2-49365-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18676466
|
Novus Biologicals
NBP2-49365 |
0.1 mL |
624.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
NUCKS1 Polyclonal antibody specifically detects NUCKS1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Especificaciones
| NUCKS1 | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ21480, FLJ32016, FLJ38536, NUCKSnuclear ubiquitous casein and cyclin-dependent kinases substrate, nuclear casein kinase and cyclin-dependent kinase substrate 1, nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate, P1, potential LAG1 interactor | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 64710 | |
| IgG | |
| Immunogen affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto