missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ NRAS (Human) Recombinant Protein

Abnova™ NRAS (Human) Recombinant Protein

Código de producto. 16162075
Change view
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Código de producto. Cantidad unitSize
16162075 10 μg 10 microgramos
16172075 25 μg 25 microgramos
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16162075

Marca: Abnova™ H00004893P01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Especificaciones

Número de acceso NP_002515.1
ID de gen (Entrez) 4893
Nombre neuroblastoma RAS viral (v-ras) oncogene homolog
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Cantidad 10 μg
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen ALPS4, N-ras, NRAS1
Símbolo de gen NRAS
Especie Wheat Germ (in vitro)
Etiqueta de proteína GST
Tampón 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Mostrar más Mostrar menos
Título del producto
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.