missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 18328318

NRAMP2/SLC11A2/DMT1 Antibody (4G2), Novus Biologicals™

Código de producto. 18328318 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mg
Tamaño de la unidad:
0.01 miligramo
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18328318 0.1 mg 0.01 miligramo
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18328318 Proveedor Novus Biologicals N.º de proveedor H00004891M03

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Monoclonal Antibody

NRAMP2/SLC11A2/DMT1 Monoclonal antibody specifically detects NRAMP2/SLC11A2/DMT1 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno NRAMP2/SLC11A2/DMT1
Aplicaciones Western Blot, ELISA, Immunocytochemistry
Clasificación Monoclonal
Clon 4G2
Conjugado Unconjugated
Dilución Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulación In 1x PBS, pH 7.4
N.º de referencia del gen NP_000608
Alias de gen DCT1NRAMP 2, Divalent cation transporter 1, Divalent metal transporter 1, DMT-1, DMT1FLJ37416, member 2, NRAMP2natural resistance-associated macrophage protein 2, solute carrier family 11 (proton-coupled divalent metal ion transporters)
Especie del huésped Mouse
Inmunógeno SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Método de purificación IgG purified
Cantidad 0.1 mg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 4891
Especies diana Human
Contenido y almacenamiento Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG2b κ
Mostrar más Mostrar menos
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.