missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ MTR Antibody Blocking Peptide

Código de producto. 18246638 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Código de producto. Cantidad unitSize
18246638 100 μg 100 microgramos
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18246638

Marca: Novus Biologicals™ NBP179285PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
Ver productos alternativos

Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A blocking peptide from human MTR. Source: Synthetic Amino Acid Sequence: (Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. The MTR Blocking Peptide is derived from Synthetic. The MTR Blocking Peptide has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 4548
Especie Human
Número de acceso Q99707
Contenido y almacenamiento Store at -20 C. Avoid freeze-thaw cycles.
Formulación Lyophilized from sterile distilled water.
Para utilizar con (aplicación) This Peptide is Useful as a Blocking Peptide for NBP1-79285. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Alias de gen 5-methyltetrahydrofolate-homocysteine methyltransferase, 5-methyltetrahydrofolate-homocysteine methyltransferase 1, cblG, cobalamin-dependent methionine synthase, EC 2.1.1.13, FLJ33168, FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase, FLJ45386, methionine synthase, MS, Vitamin-B12 dependent methionine synthase
Símbolo de gen MTR
Peso molecular 140kDa
Tipo de producto MTR
Cantidad 100 μg
Estado normativo RUO - research use only
Terminación Synthetic peptide from the C terminal of human MTR Peptide sequence GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.