missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ MTR Antibody Blocking Peptide
Tienda Bio Techne Productos
Click to view available options
Cantidad:
100 μg
Tamaño de la unidad:
100 microgramos
Descripción
A blocking peptide from human MTR. Source: Synthetic Amino Acid Sequence: (Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. The MTR Blocking Peptide is derived from Synthetic. The MTR Blocking Peptide has been validated for the following applications: Antibody Competition.
Especificaciones
Especificaciones
| Gene ID (Entrez) | 4548 |
| Especie | Human |
| Número de acceso | Q99707 |
| Contenido y almacenamiento | Store at -20 C. Avoid freeze-thaw cycles. |
| Formulación | Lyophilized from sterile distilled water. |
| Para utilizar con (aplicación) | This Peptide is Useful as a Blocking Peptide for NBP1-79285. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here . |
| Alias de gen | 5-methyltetrahydrofolate-homocysteine methyltransferase, 5-methyltetrahydrofolate-homocysteine methyltransferase 1, cblG, cobalamin-dependent methionine synthase, EC 2.1.1.13, FLJ33168, FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase, FLJ45386, methionine synthase, MS, Vitamin-B12 dependent methionine synthase |
| Símbolo de gen | MTR |
| Peso molecular | 140kDa |
| Tipo de producto | MTR |
| Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido