missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. NLRP1/NALP1 Antibody, Novus Biologicals™

NLRP1/NALP1 Antibody, Novus Biologicals™

Código de producto. 18222701 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18222701 100 μL 100 microlitros
18633388 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18222701 Proveedor Novus Biologicals N.º de proveedor NBP257196

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

NLRP1/NALP1 Polyclonal specifically detects NLRP1/NALP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno NLRP1/NALP1
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
Símbolos de los genes NLRP1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Apoptosis
Primario o secundario Primary
ID de gen (Entrez) 22861
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.