missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NFkB2/NFkB p100 Monoclonal antibody specifically detects NFkB2/NFkB p100 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antígeno | NFkB2/NFkB p100 |
| Aplicaciones | ELISA, Western Blot |
| Clasificación | Monoclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Formulación | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Alias de gen | CVID10;H2TF1;LYT10;LYT-10;NF-kB2;Nuclear factor NF-kappa-B p100 subunit;p100;p49/p100;p52 |
| Especie del huésped | Rabbit |
| Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NFkB2/NFkB p100 (NP_001070962.1).,, Sequence:, LRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH |
| Método de purificación | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?