missing translation for 'onlineSavingsMsg'
Learn More

Nectin-1/PVRL1 Antibody, Novus Biologicals™

Product Code. 18410831 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
25 μL
0.1 mL
Unit Size:
0.10 ml
25 microlitros
Product Code. Cantidad unitSize
18410831 25 μL 25 microlitros
18208916 0.1 mL 0.10 ml
2 options
This item is not returnable. View return policy

Product Code. 18410831

Brand: Novus Biologicals NBP18655425ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Nectin-1/PVRL1 Polyclonal specifically detects Nectin-1/PVRL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Nectin-1/PVRL1
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen CD111, CD111 antigen, CLPED1ectodermal dysplasia 4 (Margarita Island type), ED4, Herpes virus entry mediator C, Herpesvirus entry mediator C, Herpesvirus Ig-like receptor, HIgRPVRR, HveC, HVECpoliovirus receptor-like 1, MGC142031, Nectin-1, OFC7nectin 1, poliovirus receptor-related 1 (herpesvirus entry mediator C), poliovirus receptor-related protein 1, PRR, PRR1MGC16207, PVRR1nectin-1, SK-12
Símbolos de los genes NECTIN1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Neuroscience
Primario o secundario Primary
ID de gen (Entrez) 5818
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.